SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044UUI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044UUI6
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily Histone-fold 2.84e-46
Family Nucleosome core histones 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A044UUI6
Sequence length 127
Comment (tr|A0A044UUI6|A0A044UUI6_ONCVO) Histone H2A {ECO:0000256|RuleBase:RU003767} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MSGRGKGGKAKSSAKAKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYL
AAEVLELAGNAARDNKKSRINPRHLQLAVRNDEELNKLLSGVTIAQGGVLPNIHAVLLPK
KIAGDKE
Download sequence
Identical sequences A0A044UUI6 A0A0K0J7V9 A0A0N4TJ40 A0A182DZ34 A0A183I4V1 A0A1I7VUB8 J9ERE8
LOAG_06256T0 OVOC7794 XP_001893648.1.25112 XP_001895618.1.25112 XP_003141840.1.37734 Bm1_10880 Bm1_20820 Bm2877 WUBG_04001T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]