SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A058Z7D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A058Z7D4
Domain Number 1 Region: 113-225
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000574
Family Regulator of G-protein signaling, RGS 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A058Z7D4
Sequence length 968
Comment (tr|A0A058Z7D4|A0A058Z7D4_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KCV69991.1} KW=Complete proteome; Reference proteome OX=691883 OS=Fonticula alba. GN=H696_03456 OC=Eukaryota; Nucleariidae and Fonticula group; Fonticula.
Sequence
MSLSTPASPTGLTMPMLPLIERSSSSASARSLGGTSDGSSLGFGMPTLSPAPAPAPRSGP
MPGRLTINTGTFDAAPVAGLPLSLTGPLKPSHCNFEVLVRVSVGPDSDAFGEAAMRDFDE
YCTASFCSEIPLFYRRVIRYQQWHPQLTLGDRIRIPYVIYSNFIVSNAPNEINLDHRCRQ
QIIDCLAPHAAHIDRLAELIEADAAPVPPPSDVFDSALKEIVLQLDCLVRTWALTRVGDV
RMRTCLYRLRNRAESSSSSASSPSSPLAELCRRGAISGGSLAFRGRNGAAAAAAAVATAA
ALTTTASTAEAGAAGVEEQSAAQQAPLLAPSAEQADGGGTECQLRPAPRPAGVGRPTRRP
LSQHAGLASLAAADGLNHHRSGYEATMLRTPVTPEPAAAEALLAGAGAPGGGRLCATPPP
TPPNVPPGAGSGRRSASSGPGASTATGTHGGPHGPEGSGSAGGLPASAGALPPPSSSSSS
SSSSSFMGTSGTGSHTADGGPTGSTSPMLAGVFSPSHHKRSASIQASSGSLLRPGSGGSS
QLGSAASAEALITPSNSESFYPSPGHGGGYPLSPATSSASLLSLSGGSTQTISSISSVGS
HSSSAESLGGLLLLPSPLPPSSSSLSSSSSSSSAAPTTTAGGAGAFSSSTPPPSLGPEAK
AGRESDRRSGGVSALARSARSSVSSLFSLESSRRGRPRSSSSAASLSSMGIRPGGRSAVG
AGSSATSLGGTPGPGMATHHGTLSSQSLGGVPCHGAPRSPAGSDALPYWALAGPGGGGGG
YCVEGLGSTVSSLSIDTSFPSSPLATAIDYAEGLEDNGDGDADDDDDEDFSTPTGTQWRA
PTPYPGDSPEDVALGAGPPRSPLTAGSGGPPFPALRRASGPVPSSPLSATCYYPPGGDKL
SVGSMVLGGGATGAALAMATGKGVAAPGPGSSEDDDSGDDTTLMMRSLSDTDNPSDELSL
IEALNSLF
Download sequence
Identical sequences A0A058Z7D4
XP_009495597.1.24044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]