SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A058ZVJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A058ZVJ5
Domain Number - Region: 9-66
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00458
Family DBL homology domain (DH-domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A058ZVJ5
Sequence length 83
Comment (tr|A0A058ZVJ5|A0A058ZVJ5_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW45833.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_L00347 OC=Eucalypteae; Eucalyptus.
Sequence
MSRQSDTKLILFSNPHSLHASHKFFSFLLQTLCKEKSCRLLNIQNTFLAKKEIQKIKSSL
HYYYEASRNIYLAWLKGKKRKRK
Download sequence
Identical sequences A0A058ZVJ5
Eucgr.L00347.1|PACid:23605636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]