SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059A9J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059A9J6
Domain Number 1 Region: 155-273
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.31e-30
Family Elongation factor TFIIS domain 2 0.0022
Further Details:      
 
Domain Number 2 Region: 3-64
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000000000000549
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0034
Further Details:      
 
Domain Number 3 Region: 280-327
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000119
Family Transcriptional factor domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059A9J6
Sequence length 327
Comment (tr|A0A059A9J6|A0A059A9J6_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW50331.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_J00105 OC=Eucalypteae; Eucalyptus.
Sequence
EGKCIDALRRLKSFPVTSQVLVSTQVGKGLRRLTKHPRKKIQAYASDLIQLWKQVVMEES
NGCKKNGSVDHNEPAKARENKFKKSSSFRIEGIPKFEATKVRKTERNGTPSDKMSRSDVG
GTEKAVCDRNLQGSVKVETTTATKEEKPNCHVNKLSPNPVQSLSASVAKCNDPMRDRVRE
LLFEALSRVSGEASKDIIDEVNACDPSSIAVSVESTMFQSWGRMNGAHKMKYRSIMFNIK
DPNNPDFRRKVLLGHVKPERLLDMTTEEMASDERQLQNRQIKEKALFECELGAAPKATTD
QFKCGRCGQRKCTYYQMQTRSADEPMT
Download sequence
Identical sequences A0A059A9J6
Eucgr.J00105.1|PACid:23597774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]