SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059AE60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059AE60
Domain Number 1 Region: 68-173
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000137
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059AE60
Sequence length 174
Comment (tr|A0A059AE60|A0A059AE60_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW51675.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_J011561 OC=Eucalypteae; Eucalyptus.
Sequence
MASPIEEGTERDLEKGLVSVEPSRIATAEPSPSPSPSSTSAGPALVLSNSGKRIDQAGKK
KYVKQVTGRHNDTELHLAAQRGDLAAVKQILEDINSQMVGTLSGTDFDVEVAEVRAAVVN
EVNELGETPLYTAAEKGHLDVVKELLKYSNKDCVMKKNRSGFDALHTAASQGHH
Download sequence
Identical sequences A0A059AE60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]