SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059AK01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A059AK01
Domain Number - Region: 18-52
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0412
Family BRCA2 tower domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059AK01
Sequence length 189
Comment (tr|A0A059AK01|A0A059AK01_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW54168.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_I00145 OC=Eucalypteae; Eucalyptus.
Sequence
MASPVFTGENYQAWAVKMKAFLEGHDLWEAVEDDYEVAPLPNNLTMNQIKLHKERTIRKA
KAKSCLYATVSPTIFTRIMKCDSAKVIWDFLKEEYEGDEKIRGMKVLNLLREFERQQMKE
SESVKEYSDRLVGIADKIRVLGTDLRDDRLVQKILVSLPEKFEATITSLENTRDLANIKL
AELLNALQA
Download sequence
Identical sequences A0A059AK01
Eucgr.I00145.1|PACid:23594668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]