SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059ALQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059ALQ3
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000327
Family HLH, helix-loop-helix DNA-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059ALQ3
Sequence length 151
Comment (tr|A0A059ALQ3|A0A059ALQ3_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW54694.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_I006341 OC=Eucalypteae; Eucalyptus.
Sequence
MDKASVLGDAIKYLKQLQERVKSLEEQSKKKTMESAVFVKKYQLSNDDDGSSCDESSDGY
SADQALPEIEARVADKDVLIRIHCENQKAIAARIFGEVEKLNLSIVQSNVVRFGSSTLDI
TIVAQMDDGFSLTVKEIVKNLRSSLLKFWFR
Download sequence
Identical sequences A0A059ALQ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]