SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059B875 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059B875
Domain Number 1 Region: 34-266
Classification Level Classification E-value
Superfamily L domain-like 2.27e-32
Family Polygalacturonase inhibiting protein PGIP 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059B875
Sequence length 267
Comment (tr|A0A059B875|A0A059B875_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW62328.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_H049701 OC=Eucalypteae; Eucalyptus.
Sequence
MASASAFAPLILWTLLVFQSFEFGHFEAFTNVSCFGTEREALLKFRQGLIDHSKRLSSWT
NKDCCEWKGVKCSKKTGHVFKLDLRNPFCETFPDGYDSCSDESRLAGKIHASLAELKHLK
YLDLSLNEFSKQKTPQFFGTLPRLEYLNLSFAGFDGNIPRHLGNLSNLQYLDLTNGFDGD
YLTTDNLQWVSKLSSLKYFHLSHAYLRNATDWLSSINMLSSLQSLQLKYCSLEKLPHSLS
VNFTSLRFLDLSGNFINSTIPSWFYNC
Download sequence
Identical sequences A0A059B875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]