SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059BEZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A059BEZ3
Domain Number - Region: 30-90
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 0.0667
Family MgtE membrane domain-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059BEZ3
Sequence length 213
Comment (tr|A0A059BEZ3|A0A059BEZ3_EUCGR) Reticulon-like protein {ECO:0000256|RuleBase:RU363132} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_G02275 OC=Eucalypteae; Eucalyptus.
Sequence
IMPIYSSDSDDHPRPSQKPLGHQRPLHDILGRGKFADVLLWKNKKLSLGILIGVTAIWFL
FEVAEYHFVTLLCHLILAAMIIIFIWSNLADLIQRDPPNVYSFQLSEAGCRYLHRKIDKL
LSMIYYVSSGNDWRLLFGAIAFLWMLSVLGNYVSSWNLLYFAFVCIETLPALYERYENQV
DHLAGKSRRGAKKLYKKFDSEVLDKIPRGPRLE
Download sequence
Identical sequences A0A059BEZ3
Eucgr.G02275.1|PACid:23587872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]