SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059BRC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059BRC3
Domain Number 1 Region: 2-150
Classification Level Classification E-value
Superfamily Annexin 1.02e-53
Family Annexin 0.000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059BRC3
Sequence length 169
Comment (tr|A0A059BRC3|A0A059BRC3_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW68828.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_F02431 OC=Eucalypteae; Eucalyptus.
Sequence
MSTLTVPQPVPPVADDCEQLRKAFAGWGTNEKLIISILGHRNAAQRKLIRQTYAETYGED
LLKALDRELTNDFERLVVLWSLDPAERDAYLANEATKRWTSSNQVLMEIACTRSPQQLLM
ARQAYHARYKKSLEEDVAHHTTGDFRKRLRYSTRRSQRRLMASHKDFGY
Download sequence
Identical sequences A0A059BRC3
Eucgr.F02431.2|PACid:23583233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]