SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059CCU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059CCU3
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000265
Family Nucleosome core histones 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059CCU3
Sequence length 81
Comment (tr|A0A059CCU3|A0A059CCU3_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW76197.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_D00586 OC=Eucalypteae; Eucalyptus.
Sequence
MVRTKQTAQKSTGGEAPRNQLANKAKSHRFCPGTVALQEIRKYQKSKELLMALQEAMEVY
LGVTIMPKDIQLARRIRGERA
Download sequence
Identical sequences A0A059CCU3
Eucgr.D00586.1|PACid:23574343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]