SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059CF95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059CF95
Domain Number 1 Region: 20-157
Classification Level Classification E-value
Superfamily TRAF domain-like 1.06e-28
Family MATH domain 0.0035
Further Details:      
 
Domain Number 2 Region: 182-239
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000507
Family MATH domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059CF95
Sequence length 252
Comment (tr|A0A059CF95|A0A059CF95_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW77143.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_D01488 OC=Eucalypteae; Eucalyptus.
Sequence
MAMSCFATARESVKYKRDLPPAHFSLKIESFEVLLKLDKYDSGVFNAGGHKWRLSLYPKG
NKNDNGSGYISLYLSIDDLKSNETVHVNYKLFVHDKSRNKYLTIQDADEAISCFYGSKTQ
HGFPRFLSLKEFKKRSNGYLDEKYSCTFGAEVFVIEPDKVKEESFSLIRYPEQNTWHLKI
ENWKLLVYPKGNEAGRGKSLSVYLEVQGLTEKMQVYAEFNLSVVDQLKGRHQEKKQCMFF
WIDFYFCCFYLL
Download sequence
Identical sequences A0A059CF95
Eucgr.D01488.1|PACid:23575258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]