SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059DAL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059DAL3
Domain Number 1 Region: 161-422
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.65e-34
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 84-190
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000915
Family Pseudo ankyrin repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059DAL3
Sequence length 697
Comment (tr|A0A059DAL3|A0A059DAL3_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW87783.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_A00170 OC=Eucalypteae; Eucalyptus.
Sequence
MEGELSIEVEDGGMNNLIEIWRGRREIMKNALAASAGGQDPAKAYEYARKLARVIEGGKV
DEFLSKINVNDPLLRDIDWSAVLNSRSEGNESLLHMAAAIENDDILRLLVDYVGDHLITA
QDDRGNTPLHWVARYGGSTGAAEMLIHRARGLPNVEDKNLLLRMKNKWGNTALHIAVHEG
HANLVRYLLSEDLEPVYWKNANEKSPLYLALETYDSAVHEALFSHSLEPSRIEGLPPIHG
AIIRSRHDLFDLMLKKNMELFAMTDSNGGNVFHLAAHLNHAWVFEFLRPETEYLTREPDM
NGDLPIHIASKMGYVEHIEKLREVSLLPNGQGKNILHIAAKYGRVSVVRYILSHPILGKN
PILGKMLNAADDDGNTALHLAAMHSQPAALIDLLRTDGILPSIFNNECLLAVDIARRRHQ
AEGYNIRHQLAYLALACSLAGKGPLGNQELLLLRAKARDEELSVVRSRKSMPSRDIVKDY
INSRMVVATLVATVSFAAGFAVPGGFNGSDTASKDERGMATMLDNRMFQAFAICNTIAMF
CSMTVVVNLIWAQTVDVDVLVAAFERTTLPLQIALPAMSTAFLTGVTLTAGKLPWLANTI
FYLGLVFLLIISFAKLLGGPIFLEIFGHPLRRLTFWLILAYIYLGRVETYIYDDDDAKDN
RREKKTFASPPVDVAGESRTDDSAKAKCEDALHPPSR
Download sequence
Identical sequences A0A059DAL3
Eucgr.A00170.1|PACid:23561892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]