SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059DIV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059DIV1
Domain Number 1 Region: 9-63
Classification Level Classification E-value
Superfamily F-box domain 0.00000000157
Family F-box domain 0.0038
Further Details:      
 
Domain Number 2 Region: 95-236
Classification Level Classification E-value
Superfamily RNI-like 0.00000000589
Family Cyclin A/CDK2-associated p19, Skp2 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059DIV1
Sequence length 305
Comment (tr|A0A059DIV1|A0A059DIV1_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW90718.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_A02798 OC=Eucalypteae; Eucalyptus.
Sequence
MEESGAAIRKWEDLDTDILVKIFQTFDIFELTSRIAHVCSAWRMACCDPLLWKTLDLSAL
DSNFIRIPHEPYVYVHGQSDKEVTQLLKIALNLSQGSIQTLIFRFNLYLSDEQLTYTAER
CPLVKRIVMPAWNRIKKTGICKAINMWPHLESMTMPSIANPPYLLEEISKNCKNFSKLKI
MGPFDMQFALSLVSYIPKLKVLSLRCSVVMRDALVTILDNLQDLEVLNISHCILIEACSP
PLSKRVVKEIDPFIMNKANRLREFLVCMNDSCIMCQRARSDEGLMRWYRYEEGLWKSDEV
RSLAL
Download sequence
Identical sequences A0A059DIV1
Eucgr.A02798.1|PACid:23564780 XP_010061234.1.83385 XP_010061243.1.83385 XP_018715990.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]