SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059EG42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059EG42
Domain Number 1 Region: 39-86
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000275
Family BCR-homology GTPase activation domain (BH-domain) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059EG42
Sequence length 86
Comment (tr|A0A059EG42|A0A059EG42_9MICR) Uncharacterized protein {ECO:0000313|EMBL:KCZ73744.1} KW=Complete proteome; Reference proteome OX=1240240 OS=Anncaliia algerae PRA109. GN=H311_05297 OC=Tubulinosematidae; Anncaliia.
Sequence
SVTKYDKLDKKEKKLLKNKCRKIYNNKGFFESIIDFLNPLNDCMSCEYKPIISSFIYKVI
DYLIKEGINTIGIFRLASNNNLTNEL
Download sequence
Identical sequences A0A059EG42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]