SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059FMV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059FMV5
Domain Number 1 Region: 6-158
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 6.02e-65
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059FMV5
Sequence length 162
Comment (tr|A0A059FMV5|A0A059FMV5_9RHOB) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome; Reference proteome OX=1280950 OS=Hyphomonas johnsonii MHS-2. GN=HJO_12132 OC=Hyphomonadaceae; Hyphomonas.
Sequence
MTSSPLVGIIMGSQSDWPVMKGAADILDQMGVAHEARIVSAHRTPDRLADYAKSAAGRGL
KVIIAGAGGAAHLPGMTAAMTALPVLGVPVQSKALSGLDSLLSIVQMPKGIPVGTLAIGE
AGAVNAGLLAAAIIALGDTDVAAKLAAFRAAQTASIGEVPEG
Download sequence
Identical sequences A0A059FMV5
WP_035617134.1.13193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]