SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059IMU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059IMU5
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.53e-32
Family Chaperone J-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 116-172,216-270
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.7e-21
Family HSP40/DnaJ peptide-binding domain 0.0058
Further Details:      
 
Domain Number 3 Region: 262-348
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.14e-21
Family HSP40/DnaJ peptide-binding domain 0.0016
Further Details:      
 
Domain Number 4 Region: 137-214
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.03e-20
Family DnaJ/Hsp40 cysteine-rich domain 0.0000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059IMU5
Sequence length 378
Comment (tr|A0A059IMU5|A0A059IMU5_9RHOB) Chaperone protein DnaJ {ECO:0000256|HAMAP-Rule:MF_01152} KW=Complete proteome; Reference proteome OX=1417296 OS=Defluviimonas sp. 20V17. GN=U879_10970 OC=Rhodobacteraceae; Defluviimonas.
Sequence
MSKRDFYEVLGLQRGASPDEIKKAYRQKAKALHPDSNSDNPDAEAQFKEVNEAYDTLKDD
QKRAAYDRFGHAAFDGGMGGMGAGARGHGDFASAFSDVFEDLFGDFMGQRGGGGRRAQRG
SDLRYNLRVTLEEAYTGSQKTINVPASVACSSCNGSGAEGGAEPVTCPTCSGMGKVRAQQ
GFFTVERTCPTCSGMGQIVKNPCKACGGAGRVEKERALSVNIPPGVETGTRIRLAGEGEA
GLRGGPSGDLYIFIEVRDHALFQRDGVNLYCRVPVGMSAAALGGDIEVPTIDGGRSRVKI
PAGSQTGRQMRLRGKGMPALRGGGVGDMMIELAVETPVNLTARQKELLREFDALSEDNNP
ESSSFFSKVKGFWDSMKS
Download sequence
Identical sequences A0A059IMU5
WP_035842483.1.44061 WP_035842483.1.4639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]