SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059J0K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059J0K7
Domain Number 1 Region: 14-141
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 9.22e-28
Family Cofilin-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059J0K7
Sequence length 151
Comment (tr|A0A059J0K7|A0A059J0K7_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KDB21304.1} KW=Complete proteome; Reference proteome OX=1215338 OS=Trichophyton interdigitale MR816. GN=H109_06779 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MADHLADATIHKPSDTRLYSFSPETTEKLRKFRLGTSRAKDPQAMIYMIDAKSQEIRPVD
GEVYSKMEDLADDLPDSSPRFILLSYPLTIAGRPAVPYVLLYYLPENCNPSQRMSYANAV
ELMRSAAEVNRVIEVENETDVIEIEKKLQSQ
Download sequence
Identical sequences A0A059J0K7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]