SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059J789 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059J789
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.11e-20
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00011
Further Details:      
 
Domain Number 2 Region: 78-168
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.74e-19
Family Cold shock DNA-binding domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059J789
Sequence length 169
Comment (tr|A0A059J789|A0A059J789_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KDB23362.1} KW=Complete proteome; Reference proteome OX=1215338 OS=Trichophyton interdigitale MR816. GN=H109_04746 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MFFIHFLEHVLTLHPSFFGSHVKEYLSQKLLDDVEGICTGDYYIVCVMDMYDISEGKIIP
GSGLAEYTIVYRAIVWKPFKGETVDAIVTSVKNQGIFAEVGPLTVFVSKHLIPPEIKWDP
DSTPPQYTDNADQVIETGTNLRIKLIGLRNDVRNMFAIGSIREDYLGTL
Download sequence
Identical sequences A0A022VUP1 A0A022XK58 A0A059J789 A0A080WJD8 A0A178F357 A0A178FSN0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]