SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059J9Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059J9Y6
Domain Number 1 Region: 840-969
Classification Level Classification E-value
Superfamily PX domain 2.49e-24
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 413-560
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-21
Family Regulator of G-protein signaling, RGS 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059J9Y6
Sequence length 1206
Comment (tr|A0A059J9Y6|A0A059J9Y6_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KDB24614.1} KW=Complete proteome; Reference proteome OX=1215338 OS=Trichophyton interdigitale MR816. GN=H109_03521 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MGRMVAKHRDILFACAGGFVAWGLITSWYPLIRFIGYSFLLGATATLTSLIVVLIISVKR
PDYGSGSSRLCGQPVAFLSPDNWKQDLDDYKDNTSYQPTPLYPQSFIVSAALDELLNLIK
RDFIETWYQHISSNPGFADEIDSIVRATVGRIRDWLSKEDFVEIFVSRIVPIFTSHLKDV
DLAERAVRGRNLNHGVTESEELEIAIAARYREGNLHPAAARSSPDVAHVQQEHLRKIVVS
LLPTILPESQANSRAVLVLTREIIACAILFPLIGVLADPDTWNQLMEAYGRTALQDRKTV
RRLREALDQHALPLAKSKQGHVFPKLGPNDSEREFERFVRGIRRCNNLSDARRFRNNVAS
QLKRETMFDGHDPIYIRRLETAKRALDQKVAKLSAPNGAGNAQPSTSDQAYQNALRPQDI
SLVDVLHNAAGLSYFMEYMDRLGLMSLVQFWLVVDGFRNPLENDMGDDMTSAPSSWTTAD
RNDMILISENHLSKPELKVDEESRKVVKNFILAGKRATPEQYWKARKAVLAAQSTVLESM
KSKYYPGFKKSDLYYKYLASDEAAATTSVTSPYKQPNKPPLARSHTSGNYQPSGLSSPML
RTDSQSSTKQELRRKHSLFSSETLDTGRPSDPDHLPLFSDDIEPENLESSTYSLGKDSQS
GEAEVQEKKILENMEAALNDIISDTPNDFKADGPRSSLPSPSPRASIDMGRMDGQAAEKG
KPSISSLGLVNTSSRIGVFTDDDLFPDQEKFIEDEYADPDVPEPDIPIEEEIHEAAPGDL
GLTEAISALTADIEKLVSQESVIDSLTRKAELTNNVAELRILGKSKSSLRREIRRKEMQR
QQYVVQESDNSLYGRSTVQIPSILLDKEPDGREYALYVIEVKRQAGEQMPVASWAVPRRY
SEFHELHQRLRARYPSVRNLEFPRRRMVMKLHKDVLNKRRVALEAYLKQILLLPDVCGSR
DLRAFLSQRAIAPTREESGEGETRDIVTRLYNSVADGMDDFLGNIAVLDQLSTAGQNLIS
AATNQLNAPQAAGLGLDEAATSAEAEAELNAFEDRELEPFIKPICDIFLEIFELTRGNNW
LRGRAAVVVLHQLLGGTIERKVRENVKSLLQDSSLLHYIGLIRDTMWPDGKLREVKVRTS
SEKMKSRTEAGVMLATLIPEMAAGVVGRANAQAAARRIFSTLNNPRLNLHLVYTILDEIL
LILNGR
Download sequence
Identical sequences A0A059J9Y6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]