SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059JDB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059JDB3
Domain Number 1 Region: 532-679
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.15e-26
Family Regulator of G-protein signaling, RGS 0.00085
Further Details:      
 
Domain Number 2 Region: 390-504
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.73e-23
Family DEP domain 0.017
Further Details:      
 
Domain Number 3 Region: 213-339
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000121
Family PadR-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059JDB3
Sequence length 709
Comment (tr|A0A059JDB3|A0A059JDB3_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KDB25648.1} KW=Complete proteome; Reference proteome OX=1215338 OS=Trichophyton interdigitale MR816. GN=H109_02554 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MSRPALDRSNSLHQHPKHRPYIPLEDHIASSSSLSSSSSNHHSNSSSSNSSSKASSSPSA
ASTPTPNPNPTLALTLHSNSNSTLNSNLSVSKAFFAHPSRSSRRSLAAIAIQKTSSAFSL
GRPAAADNHHSHSHHQHQHQHHHHQHHNHHQHQHNQLQLQLQQTREEEDPFRDPDSWESD
DRPPAAAMAVSQSASKMHQTSSRLLRMTTDERPFTRDFKDLFSTLMVSLKLETHRVRFSK
FEHTFTAEEAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKEMARSVCQRFVDA
RFIESVDGRFSSQFPLKGALYQLTPKGINILHRFCQRNGITARHIMDIIDSPRNTMQLVI
LERDSVTDAISNDKGTIEVIFRRFAGQDGPNIKSSVSSSDSDSLSDYTNGVIGVKMARER
KIGDKLYQNTFTGKAAMEWLMDCCTTIDRRETMEIASLFVRQGMIACFLEDKSYMAHDPS
ATLFQPTKNAIYGVTEHGQRICGWIARERPPNSSTPSTSSAPTTVVAPRDSNNARLHHII
QDPALRLLFREFLRYSLCEENMSFYLDVSDFTANYRRAEKAGAFSKMDTVRETLASAYGL
YNAFLAPGSPCELNIDHALRNSLASRMTRAVGDDASMVKSLTDVVQLFEAAQLSVFKLMS
SDSVPKFARDPKYAAVLQEHDFDLNPTTSGRSYSPTPLPERSISRSTRS
Download sequence
Identical sequences A0A059JDB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]