SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059KNL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059KNL1
Domain Number 1 Region: 6-138
Classification Level Classification E-value
Superfamily SET domain 5.36e-31
Family Histone lysine methyltransferases 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059KNL1
Sequence length 139
Comment (tr|A0A059KNL1|A0A059KNL1_9BURK) Nuclear protein SET {ECO:0000313|EMBL:KDB52970.1} KW=Complete proteome; Reference proteome OX=1286631 OS=Sphaerotilus natans subsp. natans DSM 6575. GN=X805_13320 OC=Sphaerotilus.
Sequence
MGKPANPQKYAVINAPSRIDGTGAFAAEPIPPGRKIGEIRGEAISVQEARERVKNVDRIM
MVEISDRKAIDASRSLDPLRFTNHCCRPNAVLRIRQGRVEIHSMRQIDEGDEITCDYGET
HHEGGMTCHCGVPGCVGKL
Download sequence
Identical sequences A0A059KNL1
WP_037479751.1.49787 WP_037479751.1.61402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]