SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059KSC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059KSC4
Domain Number 1 Region: 22-199
Classification Level Classification E-value
Superfamily Lipocalins 1.17e-25
Family Rv2717c-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059KSC4
Sequence length 213
Comment (tr|A0A059KSC4|A0A059KSC4_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KDB54270.1} KW=Complete proteome; Reference proteome OX=1286631 OS=Sphaerotilus natans subsp. natans DSM 6575. GN=X805_01160 OC=Sphaerotilus.
Sequence
MSDFPQDIYTEPSGYSLDTLACLGPLRRMAGVWTGRRGLDVKPKADGPRKQAYVERLELQ
PIDPVTNGPQLLYGLRYHTHITKPEQVKTYHEQVGYWLWEPATGGVVHTLTIPRGQVAMA
AGQASAEADHFELHATQGLDTWGICSSPFLDHAFKTTAFRIRVDFHDDGSWSYEEDTVLQ
IRGRDEPFHHVDRNHLERVAEATPNPLARVKAG
Download sequence
Identical sequences A0A059KSC4
WP_037477081.1.49787 WP_037477081.1.61402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]