SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059LGX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059LGX2
Domain Number 1 Region: 242-310
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.19e-22
Family FabD-like 0.00041
Further Details:      
 
Domain Number 2 Region: 17-114
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-17
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059LGX2
Sequence length 310
Comment (tr|A0A059LGX2|A0A059LGX2_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:KDD73370.1} KW=Complete proteome; Reference proteome OX=1291522 OS=Helicosporidium sp. ATCC 50920. GN=H632_c2247p0 OC=Chlorellaceae; Helicosporidium.
Sequence
MTATGRYPPVPKFPPIAFYSAVRLGDPEQLAVIMDTDPYFITQDNGAGAPVHFATTYKQL
DMLHHLLNNGAEINQRDSKGFTPLHRAAYLAQYDGYLEVYEYLLSRGADPSIESEDFDPY
LSPGRKVPLEVAPEEPASVRQALAALEAKYRPVPKARRPHPDVGCWWTLYDYGPERVRSW
APDYVHPYPEALKRSRDALARKAAKAEHRRAKAEALKQGGGLRAAAPSDAVARSLPVPAT
PVAFLFPGQGSQAVGMLKESASIPAVQAMLATAEKVLGYDLLALCQSGPREKLDDTRYSQ
PALFVAGLAA
Download sequence
Identical sequences A0A059LGX2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]