SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059LIN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059LIN1
Domain Number 1 Region: 70-136
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000687
Family SAM (sterile alpha motif) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059LIN1
Sequence length 167
Comment (tr|A0A059LIN1|A0A059LIN1_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:KDD73985.1} KW=Complete proteome; Reference proteome OX=1291522 OS=Helicosporidium sp. ATCC 50920. GN=H632_c1676p0 OC=Chlorellaceae; Helicosporidium.
Sequence
MVDVSCTPCDLTEDGEDAACWDAVDAGCDFYDGDGALADVIEDVEAACQSPPSGDAGPDA
PAASPSAAVPPSSPPSRLAAWLARKGLGEHVPLLCGAGLTLEVLPWLTEADALALGLATF
GARRRLLLAAHELVAGKRREAEGEKATKKEECSIASSPVALVSASPD
Download sequence
Identical sequences A0A059LIN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]