SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059NTG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059NTG0
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily Histone-fold 5.65e-27
Family Nucleosome core histones 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059NTG0
Sequence length 87
Comment (tr|A0A059NTG0|A0A059NTG0_9EUPU) Histone H4 {ECO:0000256|RuleBase:RU000528} OX=1331962 OS=Orcula dolium. GN= OC=Stylommatophora; Orthurethra; Orculidae; Orcula.
Sequence
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTALDV
Download sequence
Identical sequences A0A059NTG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]