SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059SZU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059SZU5
Domain Number 1 Region: 20-106
Classification Level Classification E-value
Superfamily Immunoglobulin 9.89e-17
Family I set domains 0.057
Further Details:      
 
Domain Number 2 Region: 104-199
Classification Level Classification E-value
Superfamily Immunoglobulin 8.35e-16
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059SZU5
Sequence length 260
Comment (tr|A0A059SZU5|A0A059SZU5_9SAUR) MXRA5 {ECO:0000313|EMBL:AHG57517.1} OX=1450163 OS=Liolaemus sp. 1 MO-2014. GN=MXRA5 OC=unclassified Liolaemus.
Sequence
RQQRSSWVMIEQDQHTRFAQSVVEGSVIQLSCNVKASESPSIKWLLPDGTKLKAPFKMED
NRYSVLSSGQLVIRSVAYADSGMYHCVAQVRNDVDTMSYRVQVQPPVIQPAESEIVHVEK
NVGDPIFLPCSAVAVPDAHLSWILPNSHVLHDLSNSSNGYLLHNGTLFIPHSHVKDSGYY
RCVAINQQGSDQFCVKVTVNKIISDRSSKRAKFKKHPGSRISVKAREQIIEDIQGSGDEE
SDDTPSKKIHLKDHEVSLKQ
Download sequence
Identical sequences A0A059SXW2 A0A059SZU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]