SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059T8J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059T8J1
Domain Number 1 Region: 21-170
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 1.47e-28
Family N-acetylmuramoyl-L-alanine amidase-like 0.005
Further Details:      
 
Domain Number 2 Region: 183-247
Classification Level Classification E-value
Superfamily RPA2825-like 0.000000000275
Family RPA2825-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059T8J1
Sequence length 341
Comment (tr|A0A059T8J1|A0A059T8J1_9CAUD) N-acetylmuramoyl-L-alanine amidase {ECO:0000313|EMBL:AHL19300.1} KW=Complete proteome OX=1458855 OS=Listeria phage LP-083-2. GN=LP083-2_093 OC=Spounavirinae; P100virus.
Sequence
MVKYTVENKIIAGLPKGKLKGANFVIAHETANSKSTIDNEVSYMTRNWKNAFVTHFVGGG
GRVVQVANVNYVSWGAGQYANSYSYAQVELCRTSNATTFKKDYEVYCQLLVDLAKKAGIP
ITLDSGSKTSDKGIKSHKWVADKLGGTTHQDPYAYLSSWGISKAQFASDLAKVSGGGNTG
TAPAKPSTPAPKPSTPSTNLDKLGLVDYMNAKKMDSSYSNRAKLAKQYGIANYSGTASQN
TTLLSKIKGGAPKPSTPAPKPSTSTAKKIYFPPNKGNWSVYPTNKAPVKANAIGAINPTK
FGGLTYTIQKDRGNGVYEIQTDQFGRVQVYGAPSTGAVIKK
Download sequence
Identical sequences A0A059T6U5 A0A059T8F6 A0A059T8J1 A0A076G560 A0A088FNU9 Q30LD5 S4U9Y8
gi|525972616|ref|YP_008240059.1| gi|658607531|ref|YP_009044549.1| Q30LD5_BPA51 YP_008240059.1.33509 YP_009044549.1.22238 YP_009100998.1.76135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]