SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059U866 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059U866
Domain Number 1 Region: 2-44
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0000000000015
Family Transforming growth factor (TGF)-beta 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059U866
Sequence length 46
Comment (tr|A0A059U866|A0A059U866_9CNID) BMP2/4 {ECO:0000313|EMBL:AHZ61759.1} OX=1499104 OS=Coscinaraea monile. GN= OC=Fungiina; Coscinaraeidae; Coscinaraea.
Sequence
MAPPGYSAFYCSGECPFPIADHLNTTNHAIVQTLMNSVNADDVPPA
Download sequence
Identical sequences A0A059U866 A0A059UDM9 A0A059UGW8 A0A059UHC2 A0A059UHC7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]