SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059VQS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059VQS5
Domain Number 1 Region: 150-474
Classification Level Classification E-value
Superfamily gp120 core 1.57e-155
Family gp120 core 0.00000000182
Further Details:      
 
Domain Number 2 Region: 84-134
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000549
Family gp120 core 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059VQS5
Sequence length 474
Comment (tr|A0A059VQS5|A0A059VQS5_9HIV1) Envelope glycoprotein {ECO:0000313|EMBL:AHZ97912.1} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVKETQMNWPHLWKWGTLILGLVIICSASNNLWVTVYYGVPVWKEAKTTLFCASDAKAY
ETEVHNVWATHACVPTDPNPQEIFMENVTENFNMWNNDMAEQMHEDVISLWDQSLKPCVK
LTPLCVTLNCTNVSKNVSKSDNGIYNETRQEIRNCSFNATTLLKDKKKTVYALFYRLDIV
PLDDGKSGNNSSNSSEYRLINCNTSAITQACPKVTFDPIPIHYCAPAGFAILKCNDKRFN
GTGQCHNVSTVQCTHGIKPVVSTQLLLNGSLAEGDIIIKSENLTNNVKTIIVHLNESVEI
VCTRPNNNTRKSIRIGPGQTFYATGDIIGDIRQAHCNISKWNDTLQKISKKLIEHFPNKT
IKFXASSGGDLEITTHSFNCRGEFFYCNTSGLFNSTYLSNGXYNGTADXSNSSXITIPCR
IKQIINMWQEVGRAMYAPPIEGNITCKSNITGLLLVRDGGXEQNXTEIFRPGGG
Download sequence
Identical sequences A0A059VQS5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]