SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059VZB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A059VZB2
Domain Number - Region: 4-62
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0889
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059VZB2
Sequence length 156
Comment (tr|A0A059VZB2|A0A059VZB2_STRA9) Uncharacterized protein {ECO:0000313|EMBL:AIA04609.1} KW=Complete proteome; Reference proteome OX=68570 OS=Streptomyces albulus. GN=DC74_4127 OC=Streptomyces.
Sequence
MYGYDQNAGAGQQYGAPPPPQQPAPGGYGEQPLYPEPSPPSLADAVRAFTTGSMSAEDFQ
GIFSTSKVYCPRGDNPGFLALHNTQQPVIPMFTSLKELRRYAGKESKYFVITGAEVLDLL
PTGYGFVLDMEGDHRMVFDAKAVEQMVDFAMRRMYG
Download sequence
Identical sequences A0A059VZB2 A0A0A8ENC1 A0A0X3UW08 A0A1B2GUL4 A0A1M7K730 X0MZ15
WP_016571781.1.11189 WP_016571781.1.1222 WP_016571781.1.13977 WP_016571781.1.32176 WP_016571781.1.33444 WP_016571781.1.52517 WP_016571781.1.60932 WP_016571781.1.7375 WP_016571781.1.79501 WP_016571781.1.85733 WP_016571781.1.88743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]