SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059W437 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059W437
Domain Number 1 Region: 142-287
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.1e-16
Family SMI1/KNR4-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059W437
Sequence length 315
Comment (tr|A0A059W437|A0A059W437_STRA9) Uncharacterized protein {ECO:0000313|EMBL:AIA04058.1} KW=Complete proteome; Reference proteome OX=68570 OS=Streptomyces albulus. GN=DC74_3563 OC=Streptomyces.
Sequence
MPPNSAYAGQVVHFPDPVRAARHPAGVRMDGNGFPDFSPYARAAAEIAEPPEGFGVDELR
LTDFVSANAALHAQGHELWIDVPAVATPHGWTWHHVAGTRRMELVPVEVKALLRHHAGLA
TTAVAHDKRGTRPLQETRPVHFGLPRRELAVGEEQLVQAEEALGYRLPGAYRSFLKAAGG
CAPVGAALDAELGLLVDQPFFTVLDDAAVNDLVYVNKCLRDHFTKDYLGVAFAQGGVIAV
KVRGEAPGSVWFCPYDDARDQDGWSVQERVERLMLPCGADFDDFLLRLAGNPPELETVAN
LMVDGGFAYAVPVGG
Download sequence
Identical sequences A0A059W437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]