SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059WJW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059WJW6
Domain Number 1 Region: 59-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000576
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059WJW6
Sequence length 228
Comment (tr|A0A059WJW6|A0A059WJW6_STRA9) F-box-containing protein 2-like protein {ECO:0000313|EMBL:AIA08091.1} KW=Complete proteome; Reference proteome OX=68570 OS=Streptomyces albulus. GN=DC74_7673 OC=Streptomyces.
Sequence
MRVVEVTDDVRDQCTQLGSGVVYALRVLCAQLVDDPLRGVPGWDPSMYVVHVDGETFWQR
IESWLRRHAPTTHAALKSGASEAELAALEEVLGVRIPVRLRALWRQCAGSRDVRGAGLFP
DHGWALMDLDAVARSYEGHITSQRRWEQQFGAEEGMPLWKSSWLPFCSWSVTDLSHGRFV
DGETGETGSWGETAERTVEDESLTMLLEEMADTTGWSTRSCSRATSRG
Download sequence
Identical sequences A0A059WJW6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]