SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059WM69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059WM69
Domain Number 1 Region: 158-495
Classification Level Classification E-value
Superfamily gp120 core 1.08e-166
Family gp120 core 0.00000000132
Further Details:      
 
Domain Number 2 Region: 543-668
Classification Level Classification E-value
Superfamily Virus ectodomain 3.15e-58
Family Virus ectodomain 0.00000937
Further Details:      
 
Domain Number 3 Region: 83-148
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000114
Family gp120 core 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059WM69
Sequence length 859
Comment (tr|A0A059WM69|A0A059WM69_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} KW=Complete proteome OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVMGIRKNCQHIWKWGIMLLGILMICNADNLWVTVYYGVPVWKEATTTLFCASDAKAHD
TEVHNVWATHACVPTDPNPQEIELKNVTENFNMWKNDMVEQMHTDIVSLWDQSLKPCVKL
TPLCVTLNCSNATATPQNSTPQTTLPPNSILREDPRAIQNCSFNMATEVRDKQLKVYATF
YKLDIVPINGSNEGDNSYRLINCNTSTITQACPKVSWDPIPIHYCAPAGYAILKCNDKKF
NGTGPCKNVSTVQCTHGIKPVVSTQLLLNGSLAEESIIIRSQNISDNTKTIIVHFNEPVQ
INCTRPNNNTRKSIXLGPGRAFYTTGAIIGDIRKAYCNVNGTQWTHMLEKVGKELKYHFP
NAKIKFDSSSGGDLEITTHSFNCRGEFFYCNTSRLFTGTVVNGTLTNATITNGTITLPCR
IKQIVNMWQEVGRAMYAAPVAGSINCTSNITGLLLTRDGGKDNQTNKNEIFRPGGGNMKD
NWRSELYKYKVVEIEPLGVAPTRAKRQVVKRERRAVGIGALFLGFLGAAGSTMGAASMTL
TVQARLLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLKDQQLLGIWG
CSGKLICTTNVPWNSSWSNRSEADIWENMTWMQWEKEIGNYSTVIYRLIEESQNQQEKNE
QELLALDKWASLWNWFDISNWLWYIRIFIMIVGGLVGLRIIFSVLSIVNRVRQGYSPLSF
QTHHPAPRGPDRPEGTEEEGGERERDRSGRLVDGFLTLIWVDLRSLCLFTYRHLRDLLLI
VTRIVELLGRRGWEVLKYGWNLLQYWSQELKNSFISLLNTTAIVVAEGTDRIIEALQRGG
RAILNIPRRIRQGLERALV
Download sequence
Identical sequences A0A059WM69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]