SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059X694 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059X694
Domain Number 1 Region: 32-116
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0000235
Family Apolipoprotein A-I 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059X694
Sequence length 125
Comment (tr|A0A059X694|A0A059X694_9BACT) YtxH-like protein {ECO:0000313|EMBL:AIA15634.1} OX=77133 OS=uncultured bacterium. GN= OC=Bacteria; environmental samples.
Sequence
MASKPRFGLGLLVGAIAGVVTGLLTAPKSGKETRSDIKKKAVDVKQEAVKRTEEVKKKAG
EVAEDVKGKASEVRHNAEKIAGDVKERAETLRGHAEDAAKDVKRVAQHHANEARKDATGS
KPTPR
Download sequence
Identical sequences A0A059X694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]