SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059XVI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059XVI6
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.15e-29
Family Ribosomal L27 protein 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059XVI6
Sequence length 91
Comment (tr|A0A059XVI6|A0A059XVI6_9MOLU) 50S ribosomal protein L27 {ECO:0000256|HAMAP-Rule:MF_00539} KW=Complete proteome; Reference proteome OX=2113 OS=Mycoplasma californicum. GN=MCFN_00840 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MAKTKAGGSTKNGRDSRGQRLGIKLGDGQFCTAGSIIFRQRGTKIYPGTNAGIGKDDTIY
ALITGYVKFERRRNRTFASVYETRVVTPKNN
Download sequence
Identical sequences A0A059XVI6
WP_038561239.1.70938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]