SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060AA91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060AA91
Domain Number 1 Region: 150-500
Classification Level Classification E-value
Superfamily gp120 core 3.14e-164
Family gp120 core 0.00000000167
Further Details:      
 
Domain Number 2 Region: 548-672
Classification Level Classification E-value
Superfamily Virus ectodomain 9.51e-59
Family Virus ectodomain 0.0000102
Further Details:      
 
Domain Number 3 Region: 84-137
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000106
Family gp120 core 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060AA91
Sequence length 871
Comment (tr|A0A060AA91|A0A060AA91_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVRGILRNYPRWWIWGILGFWMLMICNGGRDRWVTVYYGVPVWKEAKTTLFCASDARAY
EREVHNVWATHACVPTDPNPQEILMENVTENFNMFKNDMVNQMHEDVISLWDQSLKPCVK
LTPLCGANVSNNVTCNNSNTCNNTYNEIKNEITNCSFNATTEIRDKKRQVYALFYKLDIV
PLFNEKNSSDGKLYSQYRLINCNTSTITQACPKVTFDPIPIHYCAPAGYAILKCNNKTFN
GTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEGIIIRSKNMTDNAKIIIVHLKEPVEI
VCTRPNNNTRKSVRIGPGQTFYATGDIIGDIRQAYCNISEANWTNTLQKVGKRLQKYFPN
KTIHFASSSGGDLEVTTHSFNCRGEFFYCNTSGLFNGSYNYNATASNSSSDNSSSVIRIP
CRIKQIINMWQEVGRAMYAPPIAGNITCKSNITGILLYHRTTVGGKENDKYWKETFRPTG
GDMRDNWRSELYKYKVVEIKPLGIAPTEARRRVVEREKRAVGVGAMFLGFLGAAGSTMGA
ASITLTVQARQLLSGIVQQQSNLLRAIEAQQHLLQLTVWGIKQLQTRVLAVERYLKDQQL
LGIWGCSGKLICTTDVPWNSSWSNRSQEEIWENMTWMQWDREISNYTNIIYHLLEDSQNQ
QEKNEKDLLALDSWKNLWNWFSISNWLWYIKIFIMIVGGLIGLRIIFAVLSIVNRVRQGY
SPLSFQIRTQNPGGPDRLGRIEEGGGEQDRNRSIRLVNGFLALVWEDLRSLCLFSYHRLR
NFVLVTARGVELLGRSSLKGLQRGWEALKYLGSLVQYWGLELKKSAISLFDAIAIAVAEG
TDRIIELVQRVCRGIYNIPRRIRQGFEAALQ
Download sequence
Identical sequences A0A060AA91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]