SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060CDT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060CDT1
Domain Number 1 Region: 10-121
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.06e-21
Family beta-Galactosidase/glucuronidase domain 0.0001
Further Details:      
 
Domain Number 2 Region: 118-164
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000000211
Family beta-glycanases 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060CDT1
Sequence length 164
Comment (tr|A0A060CDT1|A0A060CDT1_9ENTR) Glyco_hydro_2|Glyco_hydro_2_C {ECO:0000313|EMBL:AIA91195.1} OX=238202 OS=uncultured Enterobacter sp. GN= OC=Enterobacteriaceae; Enterobacter; environmental samples.
Sequence
VTLLHKPDAHIADITTNYLNSDYTRAELMLSVSMAGDHPQQYQVEASLWRHGECITRGKQ
PVGSPVIDERGHYPEQARLTLSVTTPALWSAETPHLYRLVMALVDSEGNCIDAEACEVGF
REVTIAGGLLKLNGRPLLIRGVNRHEHHPEHGQVMDEATMRQDI
Download sequence
Identical sequences A0A060CDT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]