SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060D3R5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060D3R5
Domain Number 1 Region: 122-246
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000007
Family C-type lectin domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060D3R5
Sequence length 259
Comment (tr|A0A060D3R5|A0A060D3R5_9GAMA) Putative glycoprotein {ECO:0000313|EMBL:AIB03205.1} KW=Complete proteome; Reference proteome OX=1504288 OS=Bovine gammaherpesvirus 6. GN=BoHV6Bov7 OC=Gammaherpesvirinae; Macavirus.
Sequence
MSPINPNFKVLECIKMAIKKVSIWDILLIILFGIIFIITFTLGCLALHKKLTDIRIGNYT
FPDKPSAEEIKLLILKPIDNSTNFNPEPIPGGDPKYPDAMFKFPISGFKPYVLNNSLLQE
WPKCNTCVRRVASYLWKDRCYYIPPKKYTFEECFQVCANFSQCYYFYAPQDVDDSIIRGN
LKAHEDLWIGVFKKDLSLLWETTDKMSNYSVWDVHGSYCAYIIKNQPTPISYFNCQSLKH
CLCSGVSTPPPVLQPHRRH
Download sequence
Identical sequences A0A060D3R5
gi|655872138|ref|YP_009042029.1| YP_009042029.1.71829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]