SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060DEP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060DEP9
Domain Number 1 Region: 56-174,202-238
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 4.32e-37
Family Chemotaxis phosphatase CheZ 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A060DEP9
Sequence length 239
Comment (tr|A0A060DEP9|A0A060DEP9_AZOBR) Chemotaxis protein CheZ {ECO:0000313|EMBL:AIB11175.1} KW=Complete proteome OX=192 OS=Azospirillum brasilense. GN=ABAZ39_03915 OC=Rhodospirillaceae; Azospirillum.
Sequence
MAPPVSSSLADQKLLRQQLDAAHAEAAQPLSREEVTDIVRSILGSMDGDISATDLRLYKE
VVDLARFIESAKQELAALQPAEIRDQHIPNATDELDAVVGATEQATFAIFDACDVITGIS
GQIDPGNSAKLTEQVTKIFEACNFQDITGQRISKVVRTLKHIESKVDMIVAAFGDEVRQN
HTRPAAAAVAAAEVHTDPLPNFATDRPADDPEAGLLHGPQMTSAAMDQDEIDRLLASFD
Download sequence
Identical sequences A0A060DEP9
WP_038526869.1.72791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]