SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060DQA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A060DQA2
Domain Number - Region: 14-89
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0131
Family FCH domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060DQA2
Sequence length 117
Comment (tr|A0A060DQA2|A0A060DQA2_AZOBR) Uncharacterized protein {ECO:0000313|EMBL:AIB14880.1} KW=Complete proteome OX=192 OS=Azospirillum brasilense. GN=ABAZ39_23600 OC=Rhodospirillaceae; Azospirillum.
Sequence
MSLSTSSSSPSDPRTEARRLLTDAISTYLQSCKDLAAATERATETSGSIDTQARRKAYQT
LTELGDQVRLAQRRLVTAAKQARRVMPVAEIEEVAKKLDKRDTTESAAVLVKAALVN
Download sequence
Identical sequences A0A060DQA2 G8AUD9
gi|392383869|ref|YP_005033065.1|NC_016618 gi|392383869|ref|YP_005033065.1| WP_014241891.1.1190 WP_014241891.1.16791 WP_014241891.1.59545 WP_014241891.1.72791 WP_014241891.1.8123 WP_014241891.1.92223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]