SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060DSD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060DSD1
Domain Number 1 Region: 182-278
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000206
Family Regulator of G-protein signaling, RGS 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060DSD1
Sequence length 295
Comment (tr|A0A060DSD1|A0A060DSD1_AZOBR) Uncharacterized protein {ECO:0000313|EMBL:AIB14078.1} KW=Complete proteome OX=192 OS=Azospirillum brasilense. GN=ABAZ39_19320 OC=Rhodospirillaceae; Azospirillum.
Sequence
MKIIGYPDDLIPRVASASLGTYRTRQECADLLAGMADAEKAFGSITWHKVMLLALTKPEP
LDEDTIHVYESEVDNAIARVFRKMKMLNTLAAAASKDLGALAKANPKDAVAKKALAATKA
VPGVTAKLVKVLEDAIDKDRKDIKARLAKDEATHEKQRKAAAKAAQQTNGGQFVNPFEGK
DIDDILKSSKLTLLLHAYAKTEKTDENVEFLSITRKGVDQRAALKLYNLFIDPNGAKSLN
ITGQQRTDFSNGIGNGAYVGVLKDIQTHIRIVVSGNTLTRAQALDEPALRKLGYK
Download sequence
Identical sequences A0A060DSD1
WP_040134367.1.72791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]