SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060IBR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060IBR9
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily MbtH-like 1.31e-21
Family MbtH-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060IBR9
Sequence length 72
Comment (tr|A0A060IBR9|A0A060IBR9_9RHIZ) MbtH-like protein {ECO:0000313|EMBL:AIC31074.1} KW=Complete proteome OX=1301032 OS=Rhizobium sp. IE4771. GN=IE4771_PD00520 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MDNLEPRDDLWIVVIDTEHHYSVWPQDKRIPVSWEAAGFAGSRQECLAHIREIWTDPRPL
SLRSAMAADARL
Download sequence
Identical sequences A0A060IBR9 A0A0A8GNH3
WP_040112391.1.100074 WP_040112391.1.39331 WP_040112391.1.79792 WP_040112391.1.9555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]