SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060L0R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060L0R8
Domain Number 1 Region: 150-489
Classification Level Classification E-value
Superfamily gp120 core 3.63e-174
Family gp120 core 0.000000000172
Further Details:      
 
Domain Number 2 Region: 538-662
Classification Level Classification E-value
Superfamily Virus ectodomain 5.26e-52
Family Virus ectodomain 0.0000071
Further Details:      
 
Domain Number 3 Region: 85-131
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000251
Family gp120 core 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060L0R8
Sequence length 854
Comment (tr|A0A060L0R8|A0A060L0R8_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVKEKYQHLWRWGWKWGTMLLGILIICSATEKLWVTVYYGVPVWKEATTTLFCASDAKA
YDTEVHNVWATHACIPTDPNPQEVVLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCV
KLTPLCVTLNCTDLRNDTSINNSSEEMRGEIKNCSFNITTSIRDKVKKEYALFYRLDVVP
IDNKNTSYRLINCNTSTITQACPKVSFEPIPIHYCTPAGFAILKCKDKKFNGTGPCKNVS
TVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSSNFTDNVKNIIVQLKESVEINCTRPNNNT
RKSIHIGPGRAFYATGDIIGDIRQAHCNISRAKWNNTLNQIATKLIEQFGNNKTIVFNQS
SGGNPEVVMHSFNCGGEFFYCSSTQLFNSTWKVNGTWNLTQSNGTEGSDTITLPCRIRQI
INMWQEVGKATYAPPIRGQIRCSSNITGLILTRDGGNNHNNTETFRPGGGDMRDNWKSEL
YKYKVVRIEPLGVAPTKAKRRVVQREKRAVGTIGAMFLGFLGAAGSTMGAASLTLTVQAR
LLLSGIVQQQNNLLRAIDAQQHLLQLTVWGIKQLQATVLAVERYLRDQQLLGIWGCSGKL
ICTTAVPCNASWSNKSLEQIWNNMTWMEWDRQINNYTSLIHSLIEQAQNQQENNEQELLE
LDNWASLWNWFDITNWLWYIKLFIIIVGGLIGLRIVFAVLSIVNRVRQGYSPLSFQTHLP
IPRGPNRPEGIEEEGGERDRDRSIRLVHGSLALIWEDLRSLCLFSYHRLRDLLLIITRIV
ELLGRRGWEILKHWWNLLQYWSQELKNSAVNLLNATAIAVAEGTDRVIEVLQAACRAILH
IPRRIRQGLERTLL
Download sequence
Identical sequences A0A060L0R8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]