SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060M1J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060M1J1
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Lipocalins 1.08e-30
Family Hypothetical protein YwiB 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060M1J1
Sequence length 144
Comment (tr|A0A060M1J1|A0A060M1J1_9BACI) Uncharacterized protein {ECO:0000313|EMBL:AIC96302.1} KW=Complete proteome; Reference proteome OX=1246626 OS=Bacillus lehensis G1. GN=BleG1_3755 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKRKVQISFQTMTYLEGQPPDSFSFVTEGDYYIKNNASYLRFKEAHTHGQDVYSTMKWDG
EELMLIRQGGIIMRQSFAPKQETFGRYVTPEASWETKAITETLIVQLPKANKSKGKIYVR
YHFFLQGQATGEHEIRLTIERKEE
Download sequence
Identical sequences A0A060M1J1
WP_038484159.1.24056 WP_038484159.1.57412 WP_038484159.1.72531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]