SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060M4E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060M4E9
Domain Number 1 Region: 31-82
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.000054
Family Surp module (SWAP domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060M4E9
Sequence length 159
Comment (tr|A0A060M4E9|A0A060M4E9_9BACI) Uncharacterized protein {ECO:0000313|EMBL:AIC94949.1} KW=Complete proteome; Reference proteome OX=1246626 OS=Bacillus lehensis G1. GN=BleG1_2371 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRTLIRTLPMFLLFIVLAACGYNEPEQLEEVTDEEVIEKLSTFVHDYKAEMLLAINENQT
ERLENDFLIPNTSFYHALHRLKDDLQKSNAQKELISLDVHDVWYDLEEGDYFVEAHEHVR
VVTGDAVEDIEREVRFHTVEGSDGTYRLYTIINVNEERY
Download sequence
Identical sequences A0A060M4E9
WP_038481036.1.72531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]