SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060N112 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060N112
Domain Number 1 Region: 746-992
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-62
Family Nuclear receptor ligand-binding domain 0.0000000749
Further Details:      
 
Domain Number 2 Region: 614-691
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-25
Family Nuclear receptor 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060N112
Sequence length 994
Comment (tr|A0A060N112|A0A060N112_OREMO) Mineralocorticoid receptor {ECO:0000313|EMBL:BAN57326.1} OX=8127 OS=Oreochromis mossambicus (Mozambique tilapia) (Tilapia mossambica). GN=MR OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
METKRYQSFFDGKDTENRWPQVPGTMEYCCSTEDSSLTGSDILMDIVNVNCPAGSPATDC
KDNNTKKQEQPMLQLSQNQPFVLPHFNNSLLGHKQEMDSKELSKTVAESMGLYMNAAREA
DFAFNQQGANTSPGKLYPACGRPLEENQCGPTKSPKLKPFGFQQPSATPRECTAGTPVSS
ASMLASSLSCSPQTSSAISSPGGSNNMVSSTTSPPTCFAPLCSSVSSPVSQTSCAATLAN
IKRRNSVTCSPVESSTVGSPPLTSPLNVMRSPMSSPQSMSSVRSPPSCSTTCNIRSSVSS
PTAGSCSGNTTNNCNTAMPSISSPATAGTMTVSSPQNPSSAGFPVSSPADGLGLVQNDTN
SPEAAGLTRETDFKNFEFPKVEMVDGEVFNVGLDQMGMVKYIKNEPGTDFRSMCLGSSKC
NASSTPFITQIKSEPNKSEGCMNHQPYGEQSPSIGLFPASETTYLSLRNNIDEYSLSGIL
GPPVSSVNGNYESDVFSNNVLSKGVKQESTDGSYYQENNSMSTSAIVGVNSGGHSFHYQI
GAQGTMSFTRHDMRDQTNPLLNLISPVTALMESWKSHPGMSQGSLAARGEGYPGQNCISD
GMSSSPLRQPSSTAKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCI
IDKIRRKNCPACRVRKCLQAGMNLGARKSKKLKLKGVSEDLQGSKDGQTATGGAGGYLSS
EKELNASAANALVPHRPGVVTPFLPPSICSVLELIEPEEVYSGYDNTQPDTTDHLLSSLN
RLAGKQMVRMVKWAKVLPGFRSLPIEDQITLIQYSWMCLSSFCLSWRSYKHTNGQMLYFA
PDLIFNEERMQQSAMYDLCLGMRQVSQEFVRLQLTYDEFLSMKVLLLLSTVPKEGLKNQA
AFEEMRVNYIKELRRSVGKATNNSGQTWQRFFQLTKLLDAMHDLVGNLLDFCFYTFRESQ
ALKVEFPEMLVEIISDQIPKVESGLTHTIYFHKK
Download sequence
Identical sequences A0A060N112 I3JUR6
ENSONIP00000012611 XP_003449722.1.78416 ENSONIP00000012611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]