SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060PJG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060PJG0
Domain Number 1 Region: 96-138
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 39-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000798
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060PJG0
Sequence length 138
Comment (tr|A0A060PJG0|A0A060PJG0_ONCMY) Complement component C9 {ECO:0000313|EMBL:BAO93691.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=c9 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
PALLSSEPEPIQTLIPLSMPDANTRRLNMQRATQEYEAEYSVCKCKPCHNGGSLALLDGK
CLCLCLPQFEGLACQDAKADNNKNTKTPVESVPQEGNWSCWAAWSGCSGGKRIRTRSCNT
QGLSDATCRGDIVTEDYC
Download sequence
Identical sequences A0A060PJG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]