SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060RRC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060RRC0
Domain Number 1 Region: 642-689
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000392
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060RRC0
Sequence length 922
Comment (tr|A0A060RRC0|A0A060RRC0_PLARE) Uncharacterized protein {ECO:0000313|EMBL:CDO63995.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRCDC_0822000 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MYNNFLYFPFEKFLFIFIFVVWLAFQTNKGPSYITKKYIIDDVKNIDMINHHGTVITTQN
IMCIFYILYINNLDKYKNFVQYKNFKKNKSYKYNNNIINSNSHSHSHSNSHSNSHSNSHS
HSHSNSHSHSNSHSHSHSHSRSSIQNSLFHDTNQANFLKETSYFFYKHHIYFNPKYKKDP
KILNKLKVPRNHIFYINNCDLNYYIQNYEFFFFFPYYYEHSHLYIRLDKLFYIQRCVCYR
NIRKTKKRNENIFNNMLGMKEKDRYLQNEICDIYWNYPKDNNTYDNYNFSIINYIKNIIK
KMYIYLYKVFVLKQFYHIVYYKEGIMNFYYMLFSYIYNKGCIIYNYNQMYFKKQRKKETI
IRSKRFMNEHIKEEDVDYNIVKDEKDKSIQSTEQKSYLKNNTIQYFQCFLDKAMENKNAE
NELDKWIDPESKSCYCSEESAEPCTSDDLVDINNINQIMDNTFCEYNNDNKNNNKNNNNN
NNNNNNNNNNNNNNIYHNNNIYHNNILGDHVKNIFIALSDYKILQCNEKEKKKNIIKKEQ
LYNYCKYGLNIWDNKNLYDYLNCLNVISYDKKDEKICIRKCENIKKLCNIVAQFYSFEVC
KKYYENNKHTEDIYINNFKYFSDHCKYFDPTNRGLVLCKHKNVECVYSQWSEWSTCSKTC
IENEYDTNSTRARTRLLLNKFEIPSKSCSFIINEKNNLMDINFCSHLPSCNNNNNNNDMK
KNDDERIMPFVIPIKEIEKLNTLKYLNNDDNDLLNENYKNYESIHKNNECIVTDMYQYEY
AISYNEKNKSCSCPNNQSPCYFKDIYNSQSWKKSLNILCKQNPYINVITADYIIIDCNMS
ISIKKKEIAVNTYLAMTFNCHSDIFHYIFCSKNIQSIRTNLIYIIITCAFGFISAIYIIH
IFINKWHIFKLLLHKQNKKKSY
Download sequence
Identical sequences A0A060RRC0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]