SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060SLN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060SLN3
Domain Number 1 Region: 112-263
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.49e-17
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.06
Further Details:      
 
Domain Number 2 Region: 3-106
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000346
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060SLN3
Sequence length 295
Comment (tr|A0A060SLN3|A0A060SLN3_PYCCI) Uncharacterized protein {ECO:0000313|EMBL:CDO75285.1} KW=Complete proteome; Reference proteome OX=5643 OS=cinnabarina). GN=BN946_scf184334.g3 OC=Agaricomycetes; Polyporales; Polyporaceae; Trametes.
Sequence
MKLRRQKTLQNLAAVLQAKYGSGYEVEPFGSTCYGASCSSSDIDVSILDPERPFGFDPKD
EKALPPIYSVRYADYELTDPKTGMSCDVNVNCRLGTYNTKLIRQYCLRLPPLAQYIRNIK
LWVKSKDLNNPSTRGVEPSFSSYAITLMTIAYLQSLGFLPNLQTDRYPIFETHFWERSSS
GARRTRVDVRFGARKLWKPAPGSLPPIERWFNFWAHEFDYAKEMPKQYRGDIVVLDPFQE
KNVARRISARILGLFRESCEAAVRESDVVFKANRVSDKAAELLTEEFRKALKYEP
Download sequence
Identical sequences A0A060SLN3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]